Lineage for d1wv7l1 (1wv7 L:46-82)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062284Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1062362Protein Factor IX (IXa) [57198] (2 species)
  7. 1062376Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)
  8. 1062399Domain d1wv7l1: 1wv7 L:46-82 [121321]
    Other proteins in same PDB: d1wv7h_, d1wv7l3, d1wv7t1, d1wv7t2
    automatically matched to d1pfxl1
    complexed with 5pi, bgc, ca, fuc

Details for d1wv7l1

PDB Entry: 1wv7 (more details), 2.7 Å

PDB Description: Human Factor Viia-Tissue Factor Complexed with ethylsulfonamide-D-5-propoxy-Trp-Gln-p-aminobenzamidine
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1wv7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wv7l1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

SCOPe Domain Coordinates for d1wv7l1:

Click to download the PDB-style file with coordinates for d1wv7l1.
(The format of our PDB-style files is described here.)

Timeline for d1wv7l1: