Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein automated matches [190044] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187233] (122 PDB entries) |
Domain d1wv7h_: 1wv7 H: [121320] Other proteins in same PDB: d1wv7l1, d1wv7l2, d1wv7l3, d1wv7t1, d1wv7t2 automated match to d1cvwh_ complexed with 5pi, bgc, ca, fuc |
PDB Entry: 1wv7 (more details), 2.7 Å
SCOPe Domain Sequences for d1wv7h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wv7h_ b.47.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d1wv7h_: