| Class b: All beta proteins [48724] (174 folds) |
| Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (4 families) ![]() has a few short helices inserted in loops |
| Family b.26.1.4: EssC N-terminal domain-like [141143] (1 protein) PfamB PB051221 covers two consecutive domains; the first one is of canonical topology, whereas the second domain has a cirular permutation, beginnig at strand 2 and ending at strand 1 of the canonical fold |
| Protein Protein EssC [141144] (1 species) SAV0287; similar to DNA segregation ATPase and related proteins |
| Species Staphylococcus aureus [TaxId:1280] [141145] (1 PDB entry) Uniprot Q8NYF3 1-78! Uniprot Q8NYF3 79-186 |
| Domain d1wv3a2: 1wv3 A:79-186 [121319] 2nd domain, circularly permuted topology complexed with cl |
PDB Entry: 1wv3 (more details), 1.75 Å
SCOP Domain Sequences for d1wv3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wv3a2 b.26.1.4 (A:79-186) Protein EssC {Staphylococcus aureus [TaxId: 1280]}
eadyasfaypsiqdtmtigpnayddmviqslmnaiiikdfqsiqesqyvrivhdkntdvy
inyelqeqltnkayigdhiyvegiwlevqadglnvlsqntvasslirl
Timeline for d1wv3a2: