SCOPe 2.02: Domain d1wv3a1: 1wv3 A:1-78

Lineage for d1wv3a1 (1wv3 A:1-78)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.4: EssC N-terminal domain-like [141143] (1 protein)
   PfamB PB051221 covers two consecutive domains; the first one is of canonical topology, whereas the second domain has a cirular permutation, beginnig at strand 2 and ending at strand 1 of the canonical fold

6. Protein Protein EssC [141144] (1 species)
   SAV0287; similar to DNA segregation ATPase and related proteins

7. Species Staphylococcus aureus [TaxId:1280] [141145] (1 PDB entry)
   Uniprot Q8NYF3 1-78! Uniprot Q8NYF3 79-186

8. Domain d1wv3a1: 1wv3 A:1-78 [121318]
   1st domain, canonical topology
   complexed with cl

Details for d1wv3a1

PDB Entry: 1wv3, 1.75 Å

PDB Description: Crystal structure of N-terminal domain of hypothetical protein SAV0287 from Staphylococcus aureus

PDB Compounds: (A:) similar to DNA segregation ATPase and related proteins

SCOPe Domain Sequences for d1wv3a1:

Sequence; same for both SEQRES and ATOM records:

>d1wv3a1 b.26.1.4 (A:1-78) Protein EssC {Staphylococcus aureus [TaxId: 1280]}
mhkliikynkqlkmlnlrdgktytisederaditlkslgevihleqnnqgtwqanhtsin
kvlvrkgdldditlqlyt

Timeline for d1wv3a1:

• d1wv3a1 first appeared in SCOP 1.73
  
• d1wv3a1 appears in SCOPe 2.01
  
• d1wv3a1 appears in SCOPe 2.03
  
• d1wv3a1 appears in the current release, SCOPe 2.08