Class b: All beta proteins [48724] (174 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.4: EssC N-terminal domain-like [141143] (1 protein) PfamB PB051221 covers two consecutive domains; the first one is of canonical topology, whereas the second domain has a cirular permutation, beginnig at strand 2 and ending at strand 1 of the canonical fold |
Protein Protein EssC [141144] (1 species) SAV0287; similar to DNA segregation ATPase and related proteins |
Species Staphylococcus aureus [TaxId:1280] [141145] (1 PDB entry) Uniprot Q8NYF3 1-78! Uniprot Q8NYF3 79-186 |
Domain d1wv3a1: 1wv3 A:1-78 [121318] 1st domain, canonical topology complexed with cl |
PDB Entry: 1wv3 (more details), 1.75 Å
SCOPe Domain Sequences for d1wv3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wv3a1 b.26.1.4 (A:1-78) Protein EssC {Staphylococcus aureus [TaxId: 1280]} mhkliikynkqlkmlnlrdgktytisederaditlkslgevihleqnnqgtwqanhtsin kvlvrkgdldditlqlyt
Timeline for d1wv3a1: