Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins) |
Protein GTP cyclohydrolase I [55622] (4 species) beta-sheets of five subunits form a barrel, closed: n=20, S=20 |
Species Thermus thermophilus [TaxId:274] [143627] (3 PDB entries) Uniprot Q5SH52 32-216 |
Domain d1wure_: 1wur E: [121313] automated match to d1wm9a1 complexed with 8dg, zn |
PDB Entry: 1wur (more details), 1.82 Å
SCOPe Domain Sequences for d1wure_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wure_ d.96.1.1 (E:) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]} vdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpae gsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqerl avqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreefl shlr
Timeline for d1wure_:
View in 3D Domains from other chains: (mouse over for more information) d1wura_, d1wurb_, d1wurc_, d1wurd_ |