SCOPe 2.07: Domain d1wura_: 1wur A:

Lineage for d1wura_ (1wur A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)

6. Protein GTP cyclohydrolase I [55622] (4 species)
   beta-sheets of five subunits form a barrel, closed: n=20, S=20

7. Species Thermus thermophilus [TaxId:274] [143627] (3 PDB entries)
   Uniprot Q5SH52 32-216

8. Domain d1wura_: 1wur A: [121309]
   automated match to d1wm9a1
   complexed with 8dg, zn

Details for d1wura_

PDB Entry: 1wur, 1.82 Å

PDB Description: Structure of GTP cyclohydrolase I Complexed with 8-oxo-dGTP

PDB Compounds: (A:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1wura_:

Sequence; same for both SEQRES and ATOM records:

>d1wura_ d.96.1.1 (A:) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]}
evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
lshlr

Timeline for d1wura_:

• d1wura_ first appeared in SCOP 1.73, called d1wura1
  
• d1wura_ appears in SCOPe 2.06
  
• d1wura_ appears in the current release, SCOPe 2.08