Lineage for d1wura_ (1wur A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)
  6. Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. Species Thermus thermophilus [TaxId:274] [143627] (3 PDB entries)
    Uniprot Q5SH52 32-216
  8. Domain d1wura_: 1wur A: [121309]
    automated match to d1wm9a1
    complexed with 8dg, zn

Details for d1wura_

PDB Entry: 1wur (more details), 1.82 Å

PDB Description: Structure of GTP cyclohydrolase I Complexed with 8-oxo-dGTP
PDB Compounds: (A:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1wura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wura_ d.96.1.1 (A:) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]}
evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
lshlr

SCOPe Domain Coordinates for d1wura_ are not available.

Timeline for d1wura_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wurb_, d1wurc_, d1wurd_, d1wure_