Lineage for d1wuqb1 (1wuq B:33-216)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730177Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 730178Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 730179Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 730180Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 730324Species Thermus thermophilus [TaxId:274] [143627] (3 PDB entries)
  8. 730331Domain d1wuqb1: 1wuq B:33-216 [121305]
    automatically matched to 1WM9 A:32-216
    complexed with 8gt, zn

Details for d1wuqb1

PDB Entry: 1wuq (more details), 2 Å

PDB Description: Structure of GTP cyclohydrolase I Complexed with 8-oxo-GTP
PDB Compounds: (B:) GTP cyclohydrolase I

SCOP Domain Sequences for d1wuqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuqb1 d.96.1.1 (B:33-216) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]}
vdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpae
gsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqerl
avqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreefl
shlr

SCOP Domain Coordinates for d1wuqb1:

Click to download the PDB-style file with coordinates for d1wuqb1.
(The format of our PDB-style files is described here.)

Timeline for d1wuqb1: