SCOP 1.75: Domain d1wuqa1: 1wuq A:33-216

Lineage for d1wuqa1 (1wuq A:33-216)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)

6. Protein GTP cyclohydrolase I [55622] (4 species)
   beta-sheets of five subunits form a barrel, closed: n=20, S=20

7. Species Thermus thermophilus [TaxId:274] [143627] (3 PDB entries)
   Uniprot Q5SH52 32-216

8. Domain d1wuqa1: 1wuq A:33-216 [121304]
   automatically matched to 1WM9 A:32-216
   complexed with 8gt, zn

Details for d1wuqa1

PDB Entry: 1wuq, 2 Å

PDB Description: Structure of GTP cyclohydrolase I Complexed with 8-oxo-GTP

PDB Compounds: (A:) GTP cyclohydrolase I

SCOP Domain Sequences for d1wuqa1:

Sequence; same for both SEQRES and ATOM records:

>d1wuqa1 d.96.1.1 (A:33-216) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]}
vdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpae
gsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqerl
avqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreefl
shlr

Timeline for d1wuqa1:

• d1wuqa1 first appeared in SCOP 1.73
  
• d1wuqa1 appears in SCOPe 2.01
  
• d1wuqa1 appears in the current release, SCOPe 2.08, called d1wuqa_