SCOP 1.73: Domain d1wunt2: 1wun T:109-209

Lineage for d1wunt2 (1wun T:109-209)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)

8. Domain d1wunt2: 1wun T:109-209 [121303]
   Other proteins in same PDB: d1wunh1, d1wunl1, d1wunl2, d1wunl3
   automatically matched to d1a21a2
   complexed with bgc, ca, fuc, p5b

Details for d1wunt2

PDB Entry: 1wun, 2.4 Å

PDB Description: human factor viia-tissue factor complexed with ethylsulfonamide-d-trp- gln-p-aminobenzamidine

PDB Compounds: (T:) tissue factor

SCOP Domain Sequences for d1wunt2:

Sequence, based on SEQRES records:

>d1wunt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec

Sequence, based on observed residues (ATOM records):

>d1wunt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywksgkktaktn
tneflidvdkgenycfsvqavipsrtvnrkstdspvec

Timeline for d1wunt2:

• d1wunt2 is new in SCOP 1.73
  
• d1wunt2 appears in SCOP 1.75
  
• d1wunt2 appears in the current release, SCOPe 2.08