SCOPe 2.03: Domain d1wunt1: 1wun T:6-108

Lineage for d1wunt1 (1wun T:6-108)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (32 PDB entries)
   Uniprot P13726 33-242

8. Domain d1wunt1: 1wun T:6-108 [121302]
   Other proteins in same PDB: d1wunh_, d1wunl1, d1wunl2, d1wunl3
   automatically matched to d1a21a1
   complexed with bgc, ca, fuc, p5b

Details for d1wunt1

PDB Entry: 1wun, 2.4 Å

PDB Description: human factor viia-tissue factor complexed with ethylsulfonamide-d-trp- gln-p-aminobenzamidine

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1wunt1:

Sequence, based on SEQRES records:

>d1wunt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

Sequence, based on observed residues (ATOM records):

>d1wunt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypeplyenspeftpyletnl

Timeline for d1wunt1:

• d1wunt1 first appeared in SCOP 1.73
  
• d1wunt1 appears in SCOPe 2.02
  
• d1wunt1 appears in SCOPe 2.04
  
• d1wunt1 appears in the current release, SCOPe 2.08