Lineage for d1wunl2 (1wun L:91-140)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062284Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1062362Protein Factor IX (IXa) [57198] (2 species)
  7. 1062376Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)
  8. 1062390Domain d1wunl2: 1wun L:91-140 [121300]
    Other proteins in same PDB: d1wunh_, d1wunl3, d1wunt1, d1wunt2
    automatically matched to d1pfxl2
    complexed with bgc, ca, fuc, p5b

Details for d1wunl2

PDB Entry: 1wun (more details), 2.4 Å

PDB Description: Human Factor Viia-Tissue Factor Complexed with ethylsulfonamide-D-Trp-Gln-p-aminobenzamidine
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1wunl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wunl2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

SCOPe Domain Coordinates for d1wunl2:

Click to download the PDB-style file with coordinates for d1wunl2.
(The format of our PDB-style files is described here.)

Timeline for d1wunl2: