![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
![]() | Protein Coagulation factor VIIa [50550] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50551] (33 PDB entries) |
![]() | Domain d1wunh1: 1wun H:16-257 [121298] Other proteins in same PDB: d1wunl1, d1wunl2, d1wunl3, d1wunt1, d1wunt2 automatically matched to d1cvwh_ complexed with bgc, ca, fuc, p5b |
PDB Entry: 1wun (more details), 2.4 Å
SCOP Domain Sequences for d1wunh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wunh1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d1wunh1: