SCOPe 2.05: Domain d1wuga_: 1wug A:

Lineage for d1wuga_ (1wug A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries)

8. Domain d1wuga_: 1wug A: [121286]
   automated match to d1wuma1
   complexed with np1

Details for d1wuga_

PDB Entry: 1wug

PDB Description: complex structure of pcaf bromodomain with small chemical ligand np1

PDB Compounds: (A:) Histone acetylatransferase PCAF

SCOPe Domain Sequences for d1wuga_:

Sequence; same for both SEQRES and ATOM records:

>d1wuga_ a.29.2.1 (A:) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

Timeline for d1wuga_:

• d1wuga_ first appeared in SCOP 1.73, called d1wuga1
  
• d1wuga_ appears in SCOPe 2.04
  
• d1wuga_ is called d1wuga2 in SCOPe 2.06
  
• d1wuga_ appears in the current release, SCOPe 2.08, called d1wuga2