![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.1: Bromodomain [47371] (6 proteins) |
![]() | Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries) |
![]() | Domain d1wuga2: 1wug A:719-832 [121286] Other proteins in same PDB: d1wuga3 automated match to d1wuma1 complexed with np1 |
PDB Entry: 1wug (more details)
SCOPe Domain Sequences for d1wuga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wuga2 a.29.2.1 (A:719-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} skeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlk nryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk
Timeline for d1wuga2: