Lineage for d1wuga2 (1wug A:719-832)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706796Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)
  7. 2706797Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries)
  8. 2706802Domain d1wuga2: 1wug A:719-832 [121286]
    Other proteins in same PDB: d1wuga3
    automated match to d1wuma1
    complexed with np1

Details for d1wuga2

PDB Entry: 1wug (more details)

PDB Description: complex structure of pcaf bromodomain with small chemical ligand np1
PDB Compounds: (A:) Histone acetylatransferase PCAF

SCOPe Domain Sequences for d1wuga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuga2 a.29.2.1 (A:719-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
skeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlk
nryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

SCOPe Domain Coordinates for d1wuga2:

Click to download the PDB-style file with coordinates for d1wuga2.
(The format of our PDB-style files is described here.)

Timeline for d1wuga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wuga3