SCOPe 2.07: Domain d1wudd_: 1wud D:

Lineage for d1wudd_ (1wud D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.8: HRDC-like [47819] (5 families)

5. Family a.60.8.1: HRDC domain from helicases [47820] (3 proteins)

6. Protein automated matches [190428] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188094] (1 PDB entry)

8. Domain d1wudd_: 1wud D: [121285]
   Other proteins in same PDB: d1wuda1
   automated match to d1wuda1

Details for d1wudd_

PDB Entry: 1wud, 2.2 Å

PDB Description: E. coli RecQ HRDC domain

PDB Compounds: (D:) ATP-dependent DNA helicase recQ

SCOPe Domain Sequences for d1wudd_:

Sequence; same for both SEQRES and ATOM records:

>d1wudd_ a.60.8.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
ydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsvngvgmrkler
fgkpfmalirahvdgd

Timeline for d1wudd_:

• d1wudd_ first appeared in SCOP 1.73, called d1wudd1
  
• d1wudd_ appears in SCOPe 2.06
  
• d1wudd_ appears in the current release, SCOPe 2.08