Lineage for d1wudd1 (1wud D:531-606)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643210Superfamily a.60.8: HRDC-like [47819] (4 families) (S)
  5. 643211Family a.60.8.1: HRDC domain from helicases [47820] (2 proteins)
  6. 643212Protein HRDC domain from RecQ helicase [47821] (2 species)
  7. 643215Species Escherichia coli [TaxId:562] [140639] (1 PDB entry)
  8. 643218Domain d1wudd1: 1wud D:531-606 [121285]
    automatically matched to 1WUD A:530-606

Details for d1wudd1

PDB Entry: 1wud (more details), 2.2 Å

PDB Description: E. coli RecQ HRDC domain
PDB Compounds: (D:) ATP-dependent DNA helicase recQ

SCOP Domain Sequences for d1wudd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wudd1 a.60.8.1 (D:531-606) HRDC domain from RecQ helicase {Escherichia coli [TaxId: 562]}
ydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsvngvgmrkler
fgkpfmalirahvdgd

SCOP Domain Coordinates for d1wudd1:

Click to download the PDB-style file with coordinates for d1wudd1.
(The format of our PDB-style files is described here.)

Timeline for d1wudd1: