Lineage for d1wudd_ (1wud D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716244Superfamily a.60.8: HRDC-like [47819] (5 families) (S)
  5. 2716245Family a.60.8.1: HRDC domain from helicases [47820] (3 proteins)
  6. 2716255Protein automated matches [190428] (2 species)
    not a true protein
  7. 2716256Species Escherichia coli [TaxId:562] [188094] (1 PDB entry)
  8. 2716258Domain d1wudd_: 1wud D: [121285]
    Other proteins in same PDB: d1wuda1
    automated match to d1wuda1

Details for d1wudd_

PDB Entry: 1wud (more details), 2.2 Å

PDB Description: E. coli RecQ HRDC domain
PDB Compounds: (D:) ATP-dependent DNA helicase recQ

SCOPe Domain Sequences for d1wudd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wudd_ a.60.8.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
ydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsvngvgmrkler
fgkpfmalirahvdgd

SCOPe Domain Coordinates for d1wudd_:

Click to download the PDB-style file with coordinates for d1wudd_.
(The format of our PDB-style files is described here.)

Timeline for d1wudd_: