Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (5 families) |
Family a.60.8.1: HRDC domain from helicases [47820] (3 proteins) |
Protein automated matches [190428] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [188094] (1 PDB entry) |
Domain d1wudb_: 1wud B: [121284] Other proteins in same PDB: d1wuda1 automated match to d1wuda1 |
PDB Entry: 1wud (more details), 2.2 Å
SCOPe Domain Sequences for d1wudb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wudb_ a.60.8.1 (B:) automated matches {Escherichia coli [TaxId: 562]} ydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsvngvgmrkler fgkpfmalirahvdgd
Timeline for d1wudb_: