![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.8: HRDC-like [47819] (5 families) ![]() |
![]() | Family a.60.8.1: HRDC domain from helicases [47820] (3 proteins) |
![]() | Protein HRDC domain from RecQ helicase [47821] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [140639] (1 PDB entry) Uniprot P15043 530-606 |
![]() | Domain d1wuda1: 1wud A:530-606 [121283] Other proteins in same PDB: d1wudb_, d1wudd_ |
PDB Entry: 1wud (more details), 2.2 Å
SCOPe Domain Sequences for d1wuda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wuda1 a.60.8.1 (A:530-606) HRDC domain from RecQ helicase {Escherichia coli [TaxId: 562]} nydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsvngvgmrkle rfgkpfmalirahvdgd
Timeline for d1wuda1: