Lineage for d1wuda1 (1wud A:530-606)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329380Superfamily a.60.8: HRDC-like [47819] (5 families) (S)
  5. 2329381Family a.60.8.1: HRDC domain from helicases [47820] (3 proteins)
  6. 2329382Protein HRDC domain from RecQ helicase [47821] (2 species)
  7. 2329385Species Escherichia coli [TaxId:562] [140639] (1 PDB entry)
    Uniprot P15043 530-606
  8. 2329386Domain d1wuda1: 1wud A:530-606 [121283]
    Other proteins in same PDB: d1wudb_, d1wudd_

Details for d1wuda1

PDB Entry: 1wud (more details), 2.2 Å

PDB Description: E. coli RecQ HRDC domain
PDB Compounds: (A:) ATP-dependent DNA helicase recQ

SCOPe Domain Sequences for d1wuda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuda1 a.60.8.1 (A:530-606) HRDC domain from RecQ helicase {Escherichia coli [TaxId: 562]}
nydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsvngvgmrkle
rfgkpfmalirahvdgd

SCOPe Domain Coordinates for d1wuda1:

Click to download the PDB-style file with coordinates for d1wuda1.
(The format of our PDB-style files is described here.)

Timeline for d1wuda1: