Lineage for d1wu7b2 (1wu7 B:5-329)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574233Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2574304Protein Histidyl-tRNA synthetase (HisRS) [55688] (4 species)
  7. 2574325Species Thermoplasma acidophilum [TaxId:2303] [143637] (1 PDB entry)
    Uniprot Q9HLX5 3-329
  8. 2574327Domain d1wu7b2: 1wu7 B:5-329 [121278]
    Other proteins in same PDB: d1wu7a1, d1wu7b1
    automated match to d1wu7a2

Details for d1wu7b2

PDB Entry: 1wu7 (more details), 2.4 Å

PDB Description: Crystal structure of histidyl-tRNA synthetase from Thermoplasma acidophilum
PDB Compounds: (B:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1wu7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wu7b2 d.104.1.1 (B:5-329) Histidyl-tRNA synthetase (HisRS) {Thermoplasma acidophilum [TaxId: 2303]}
qiekirgfrdfypedmdvekfifktaeeaaeafgfrridfpsleyldlyriksgeellqq
tysfvdkggrevtlipeatpstvrmvtsrkdlqrplrwysfpkvwryeepqagryrehyq
fnadifgsdspeadaevialassildrlglqdiyeirinsrkimeeiiggmtssdpfsvf
siidryhkisreefvdqlrsagigedgvsmiadlcsgtrgidemaritgksseeiarmaa
vedllasygvknvrydfsivrglsyytgivfeaydrsgqfrailgggrydnlaslmsges
vpavgfgmgdavislllkrenvqip

SCOPe Domain Coordinates for d1wu7b2:

Click to download the PDB-style file with coordinates for d1wu7b2.
(The format of our PDB-style files is described here.)

Timeline for d1wu7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wu7b1