SCOPe 2.08: Domain d1wu7b2: 1wu7 B:5-329

Lineage for d1wu7b2 (1wu7 B:5-329)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS) [55688] (4 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [143637] (1 PDB entry)
   Uniprot Q9HLX5 3-329

8. Domain d1wu7b2: 1wu7 B:5-329 [121278]
   Other proteins in same PDB: d1wu7a1, d1wu7b1
   automated match to d1wu7a2
   has additional subdomain(s) that are not in the common domain

Details for d1wu7b2

PDB Entry: 1wu7, 2.4 Å

PDB Description: Crystal structure of histidyl-tRNA synthetase from Thermoplasma acidophilum

PDB Compounds: (B:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1wu7b2:

Sequence; same for both SEQRES and ATOM records:

>d1wu7b2 d.104.1.1 (B:5-329) Histidyl-tRNA synthetase (HisRS) {Thermoplasma acidophilum [TaxId: 2303]}
qiekirgfrdfypedmdvekfifktaeeaaeafgfrridfpsleyldlyriksgeellqq
tysfvdkggrevtlipeatpstvrmvtsrkdlqrplrwysfpkvwryeepqagryrehyq
fnadifgsdspeadaevialassildrlglqdiyeirinsrkimeeiiggmtssdpfsvf
siidryhkisreefvdqlrsagigedgvsmiadlcsgtrgidemaritgksseeiarmaa
vedllasygvknvrydfsivrglsyytgivfeaydrsgqfrailgggrydnlaslmsges
vpavgfgmgdavislllkrenvqip

Timeline for d1wu7b2:

• d1wu7b2 first appeared in SCOP 1.73
  
• d1wu7b2 appears in SCOPe 2.07