Lineage for d1wu7b1 (1wu7 B:330-424)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489767Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2489768Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2489777Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 2489798Species Thermoplasma acidophilum [TaxId:2303] [142418] (1 PDB entry)
    Uniprot Q9HLX5 330-426
  8. 2489800Domain d1wu7b1: 1wu7 B:330-424 [121277]
    Other proteins in same PDB: d1wu7a2, d1wu7b2
    automated match to d1wu7a1

Details for d1wu7b1

PDB Entry: 1wu7 (more details), 2.4 Å

PDB Description: Crystal structure of histidyl-tRNA synthetase from Thermoplasma acidophilum
PDB Compounds: (B:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1wu7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wu7b1 c.51.1.1 (B:330-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
rekksvyicrvgkinssimneysrklrergmnvtveimerglsaqlkyasaigadfavif
gerdlergvvtirnmytgsqenvgldsvvehlisq

SCOPe Domain Coordinates for d1wu7b1:

Click to download the PDB-style file with coordinates for d1wu7b1.
(The format of our PDB-style files is described here.)

Timeline for d1wu7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wu7b2