SCOPe 2.08: Domain d1wu7b1: 1wu7 B:330-424

Lineage for d1wu7b1 (1wu7 B:330-424)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [142418] (1 PDB entry)
   Uniprot Q9HLX5 330-426

8. Domain d1wu7b1: 1wu7 B:330-424 [121277]
   Other proteins in same PDB: d1wu7a2, d1wu7b2
   automated match to d1wu7a1

Details for d1wu7b1

PDB Entry: 1wu7, 2.4 Å

PDB Description: Crystal structure of histidyl-tRNA synthetase from Thermoplasma acidophilum

PDB Compounds: (B:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1wu7b1:

Sequence; same for both SEQRES and ATOM records:

>d1wu7b1 c.51.1.1 (B:330-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
rekksvyicrvgkinssimneysrklrergmnvtveimerglsaqlkyasaigadfavif
gerdlergvvtirnmytgsqenvgldsvvehlisq

Timeline for d1wu7b1:

• d1wu7b1 first appeared in SCOP 1.73
  
• d1wu7b1 appears in SCOPe 2.07