Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species) |
Species Thermoplasma acidophilum [TaxId:2303] [142418] (1 PDB entry) Uniprot Q9HLX5 330-426 |
Domain d1wu7a1: 1wu7 A:330-426 [121275] Other proteins in same PDB: d1wu7a2, d1wu7b2 |
PDB Entry: 1wu7 (more details), 2.4 Å
SCOPe Domain Sequences for d1wu7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wu7a1 c.51.1.1 (A:330-426) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} rekksvyicrvgkinssimneysrklrergmnvtveimerglsaqlkyasaigadfavif gerdlergvvtirnmytgsqenvgldsvvehlisqat
Timeline for d1wu7a1: