SCOPe 2.06: Domain d1wu6a1: 1wu6 A:6-381

Lineage for d1wu6a1 (1wu6 A:6-381)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)

6. Protein Xylanase Y [140784] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [140785] (7 PDB entries)
   Uniprot Q9KB30 6-381

8. Domain d1wu6a1: 1wu6 A:6-381 [121274]
   complexed with gol, ni; mutant

Details for d1wu6a1

PDB Entry: 1wu6, 1.45 Å

PDB Description: crystal structure of reducing-end-xylose releasing exo-oligoxylanase e70a mutant complexed with xylobiose

PDB Compounds: (A:) Xylanase Y

SCOPe Domain Sequences for d1wu6a1:

Sequence; same for both SEQRES and ATOM records:

>d1wu6a1 a.102.1.2 (A:6-381) Xylanase Y {Bacillus halodurans [TaxId: 86665]}
egafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgylldtgnl
dvrtagmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtknswgp
apdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdnkli
kfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglapeya
yydgtpndekgyghffsdsyrvaanigldaewfggsewsaeeinkiqaffadkepedyrr
ykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydncly
lfamlalsgnfkiwfp

Timeline for d1wu6a1:

• d1wu6a1 first appeared in SCOP 1.73
  
• d1wu6a1 appears in SCOPe 2.05
  
• d1wu6a1 appears in SCOPe 2.07
  
• d1wu6a1 appears in the current release, SCOPe 2.08