Class a: All alpha proteins [46456] (284 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) |
Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
Protein automated matches [190108] (2 species) not a true protein |
Species Bacillus halodurans [TaxId:272558] [186832] (1 PDB entry) |
Domain d1wu5a_: 1wu5 A: [121273] automated match to d1h12a_ complexed with gol, ni, xyp |
PDB Entry: 1wu5 (more details), 2.2 Å
SCOPe Domain Sequences for d1wu5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wu5a_ a.102.1.0 (A:) automated matches {Bacillus halodurans [TaxId: 272558]} egafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgylldtgnl dvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtknswgp apdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdnkli kfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglapeya yydgtpndekgyghffsdsyrvaanigldaewfggsewsaeeinkiqaffadkepedyrr ykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydncly lfamlalsgnfkiwfp
Timeline for d1wu5a_: