SCOP 1.73: Domain d1wu5a1: 1wu5 A:6-381

Lineage for d1wu5a1 (1wu5 A:6-381)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (7 families)

5. Family a.102.1.2: Cellulases catalytic domain [48213] (11 proteins)

6. Protein Xylanase Y [140784] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [140785] (3 PDB entries)

8. Domain d1wu5a1: 1wu5 A:6-381 [121273]
   automatically matched to 1WU4 A:6-381
   complexed with gol, ni, xyp; mutant

Details for d1wu5a1

PDB Entry: 1wu5, 2.2 Å

PDB Description: crystal structure of reducing-end-xylose releasing exo-oligoxylanase complexed with xylose

PDB Compounds: (A:) Xylanase Y

SCOP Domain Sequences for d1wu5a1:

Sequence; same for both SEQRES and ATOM records:

>d1wu5a1 a.102.1.2 (A:6-381) Xylanase Y {Bacillus halodurans [TaxId: 86665]}
egafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgylldtgnl
dvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtknswgp
apdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdnkli
kfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglapeya
yydgtpndekgyghffsdsyrvaanigldaewfggsewsaeeinkiqaffadkepedyrr
ykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydncly
lfamlalsgnfkiwfp

Timeline for d1wu5a1:

• d1wu5a1 is new in SCOP 1.73
  
• d1wu5a1 appears in SCOP 1.75
  
• d1wu5a1 appears in the current release, SCOPe 2.08, called d1wu5a_