Lineage for d1wu5a1 (1wu5 A:6-381)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 645796Superfamily a.102.1: Six-hairpin glycosidases [48208] (7 families) (S)
  5. 645810Family a.102.1.2: Cellulases catalytic domain [48213] (11 proteins)
  6. 645892Protein Xylanase Y [140784] (1 species)
  7. 645893Species Bacillus halodurans [TaxId:86665] [140785] (3 PDB entries)
  8. 645896Domain d1wu5a1: 1wu5 A:6-381 [121273]
    automatically matched to 1WU4 A:6-381
    complexed with gol, ni, xyp; mutant

Details for d1wu5a1

PDB Entry: 1wu5 (more details), 2.2 Å

PDB Description: crystal structure of reducing-end-xylose releasing exo-oligoxylanase complexed with xylose
PDB Compounds: (A:) Xylanase Y

SCOP Domain Sequences for d1wu5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wu5a1 a.102.1.2 (A:6-381) Xylanase Y {Bacillus halodurans [TaxId: 86665]}
egafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgylldtgnl
dvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtknswgp
apdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdnkli
kfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglapeya
yydgtpndekgyghffsdsyrvaanigldaewfggsewsaeeinkiqaffadkepedyrr
ykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydncly
lfamlalsgnfkiwfp

SCOP Domain Coordinates for d1wu5a1:

Click to download the PDB-style file with coordinates for d1wu5a1.
(The format of our PDB-style files is described here.)

Timeline for d1wu5a1: