SCOPe 2.08: Domain d1wu5a_: 1wu5 A:

Lineage for d1wu5a_ (1wu5 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.0: automated matches [191318] (1 protein)
   not a true family

6. Protein automated matches [190108] (23 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [186832] (1 PDB entry)

8. Domain d1wu5a_: 1wu5 A: [121273]
   automated match to d1h12a_
   complexed with gol, ni, xyp

Details for d1wu5a_

PDB Entry: 1wu5, 2.2 Å

PDB Description: crystal structure of reducing-end-xylose releasing exo-oligoxylanase complexed with xylose

PDB Compounds: (A:) Xylanase Y

SCOPe Domain Sequences for d1wu5a_:

Sequence; same for both SEQRES and ATOM records:

>d1wu5a_ a.102.1.0 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
egafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgylldtgnl
dvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtknswgp
apdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdnkli
kfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglapeya
yydgtpndekgyghffsdsyrvaanigldaewfggsewsaeeinkiqaffadkepedyrr
ykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydncly
lfamlalsgnfkiwfp

Timeline for d1wu5a_:

• d1wu5a_ first appeared in SCOP 1.73, called d1wu5a1
  
• d1wu5a_ appears in SCOPe 2.07