Lineage for d1wu4a1 (1wu4 A:6-381)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004162Protein Xylanase Y [140784] (1 species)
  7. 2004163Species Bacillus halodurans [TaxId:86665] [140785] (7 PDB entries)
    Uniprot Q9KB30 6-381
  8. 2004164Domain d1wu4a1: 1wu4 A:6-381 [121272]
    complexed with gol, ni

Details for d1wu4a1

PDB Entry: 1wu4 (more details), 1.35 Å

PDB Description: Crystal structure of reducing-end-xylose releasing exo-oligoxylanase
PDB Compounds: (A:) Xylanase Y

SCOPe Domain Sequences for d1wu4a1:

Sequence, based on SEQRES records: (download)

>d1wu4a1 a.102.1.2 (A:6-381) Xylanase Y {Bacillus halodurans [TaxId: 86665]}
egafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgylldtgnl
dvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtknswgp
apdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdnkli
kfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglapeya
yydgtpndekgyghffsdsyrvaanigldaewfggsewsaeeinkiqaffadkepedyrr
ykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydncly
lfamlalsgnfkiwfp

Sequence, based on observed residues (ATOM records): (download)

>d1wu4a1 a.102.1.2 (A:6-381) Xylanase Y {Bacillus halodurans [TaxId: 86665]}
egafytreyrnlfkefgyseaeiqervkdtweqlfgdnpkiyyevgddlgylldtgnldv
rtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtknswgpap
dgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdnklikf
ipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglapeyayy
dgtpndekgyghffsdsyrvaanigldaewfggsewsaeeinkiqaffadkepedyrryk
idgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydnclylf
amlalsgnfkiwfp

SCOPe Domain Coordinates for d1wu4a1:

Click to download the PDB-style file with coordinates for d1wu4a1.
(The format of our PDB-style files is described here.)

Timeline for d1wu4a1: