![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.106: Phage tail proteins [69278] (1 superfamily) core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel |
![]() | Superfamily b.106.1: Phage tail proteins [69279] (4 families) ![]() |
![]() | Family b.106.1.1: Baseplate protein-like [69280] (4 proteins) duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions |
![]() | Protein Baseplate structural protein gp27 [69281] (1 species) |
![]() | Species Bacteriophage T4 [TaxId:10665] [69282] (3 PDB entries) |
![]() | Domain d1wthd2: 1wth D:201-377 [121269] automated match to d1k28d2 complexed with k, po4; mutant |
PDB Entry: 1wth (more details), 2.8 Å
SCOPe Domain Sequences for d1wthd2:
Sequence, based on SEQRES records: (download)
>d1wthd2 b.106.1.1 (D:201-377) Baseplate structural protein gp27 {Bacteriophage T4 [TaxId: 10665]} dmminqepypmivgepsligqfiqelkyplaydfvwltksnphkrdpmknatiyahsfld ssipmittgkgensivvsrsgaysemtyrngyeeairlqtmaqydgyakcstignfnltp gvkiifndsknqfktefyvdevihelsnnnsvthlymftnatkletidpvkvknefk
>d1wthd2 b.106.1.1 (D:201-377) Baseplate structural protein gp27 {Bacteriophage T4 [TaxId: 10665]} dmminqepypmivgepsqelkyplaydfvwltksnphkrdpmknatiyahsfldssipmi ttgkgensivvsrsgaysemtyrngyeeairlqtmaqydgyakcstignfnltpgvkiif ndsknqfktefyvdevihelsnnnsvthlymftnatkletidpvkvknefk
Timeline for d1wthd2: