SCOPe 2.05: Domain d1wthd1: 1wth D:4-200

Lineage for d1wthd1 (1wth D:4-200)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.106: Phage tail proteins [69278] (1 superfamily)
   core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel

4. Superfamily b.106.1: Phage tail proteins [69279] (3 families)

5. Family b.106.1.1: Baseplate protein-like [69280] (3 proteins)
   duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions

6. Protein Baseplate structural protein gp27 [69281] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [69282] (3 PDB entries)

8. Domain d1wthd1: 1wth D:4-200 [121268]
   automated match to d1k28d1
   complexed with k, po4; mutant

Details for d1wthd1

PDB Entry: 1wth, 2.8 Å

PDB Description: crystal structure of gp5-s351l mutant and gp27 complex

PDB Compounds: (D:) Baseplate structural protein Gp27

SCOPe Domain Sequences for d1wthd1:

Sequence, based on SEQRES records:

>d1wthd1 b.106.1.1 (D:4-200) Baseplate structural protein gp27 {Bacteriophage T4 [TaxId: 10665]}
lqrpgypnlsvklfdsydawsnnrfvelaatittltmrdslygrnegmlqfydsknihtk
mdgneiiqisvanandinnvktriygckhfsvsvdskgdniiaielgtihsienlkfgrp
ffpdagesikemlgviyqdrtlltpainainayvpdipwtstfenylsyvrevalavgsd
kfvfvwqdimgvnmmdy

Sequence, based on observed residues (ATOM records):

>d1wthd1 b.106.1.1 (D:4-200) Baseplate structural protein gp27 {Bacteriophage T4 [TaxId: 10665]}
lqrpgypnlsvklfdsydawsnnrfvelaatittltmrdslygrnegmlqfydsknihtk
mdgneiiqisvanandinnvktriygckhfsvsiiaielgtihsienlkfgrpffpdage
sikemlgviyqdrtlltpainainayvpdipwtstfenylsyvrevalavgsdkfvfvwq
dimgvnmmdy

Timeline for d1wthd1:

• d1wthd1 first appeared in SCOP 1.73
  
• d1wthd1 appears in SCOPe 2.04
  
• d1wthd1 appears in SCOPe 2.06
  
• d1wthd1 appears in the current release, SCOPe 2.08