Lineage for d1wthd1 (1wth D:4-200)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409351Fold b.106: Phage tail proteins [69278] (1 superfamily)
    core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel
  4. 2409352Superfamily b.106.1: Phage tail proteins [69279] (4 families) (S)
  5. 2409353Family b.106.1.1: Baseplate protein-like [69280] (3 proteins)
    duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions
  6. 2409376Protein Baseplate structural protein gp27 [69281] (1 species)
  7. 2409377Species Bacteriophage T4 [TaxId:10665] [69282] (3 PDB entries)
  8. 2409380Domain d1wthd1: 1wth D:4-200 [121268]
    automated match to d1k28d1
    complexed with k, po4; mutant

Details for d1wthd1

PDB Entry: 1wth (more details), 2.8 Å

PDB Description: Crystal structure of gp5-S351L mutant and gp27 complex
PDB Compounds: (D:) Baseplate structural protein Gp27

SCOPe Domain Sequences for d1wthd1:

Sequence, based on SEQRES records: (download)

>d1wthd1 b.106.1.1 (D:4-200) Baseplate structural protein gp27 {Bacteriophage T4 [TaxId: 10665]}
lqrpgypnlsvklfdsydawsnnrfvelaatittltmrdslygrnegmlqfydsknihtk
mdgneiiqisvanandinnvktriygckhfsvsvdskgdniiaielgtihsienlkfgrp
ffpdagesikemlgviyqdrtlltpainainayvpdipwtstfenylsyvrevalavgsd
kfvfvwqdimgvnmmdy

Sequence, based on observed residues (ATOM records): (download)

>d1wthd1 b.106.1.1 (D:4-200) Baseplate structural protein gp27 {Bacteriophage T4 [TaxId: 10665]}
lqrpgypnlsvklfdsydawsnnrfvelaatittltmrdslygrnegmlqfydsknihtk
mdgneiiqisvanandinnvktriygckhfsvsiiaielgtihsienlkfgrpffpdage
sikemlgviyqdrtlltpainainayvpdipwtstfenylsyvrevalavgsdkfvfvwq
dimgvnmmdy

SCOPe Domain Coordinates for d1wthd1:

Click to download the PDB-style file with coordinates for d1wthd1.
(The format of our PDB-style files is described here.)

Timeline for d1wthd1: