Lineage for d1wtgt2 (1wtg T:109-209)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761786Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2761787Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
    Uniprot P13726 33-242
  8. 2761812Domain d1wtgt2: 1wtg T:109-209 [121267]
    Other proteins in same PDB: d1wtgh_, d1wtgl1, d1wtgl2, d1wtgl3
    automatically matched to d1a21a2
    complexed with 3bp, bgc, ca, fuc

Details for d1wtgt2

PDB Entry: 1wtg (more details), 2.2 Å

PDB Description: human factor viia-tissue factor complexed with ethylsulfonamide-d- biphenylalanine-gln-p-aminobenzamidine
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1wtgt2:

Sequence, based on SEQRES records: (download)

>d1wtgt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec

Sequence, based on observed residues (ATOM records): (download)

>d1wtgt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywksgkktaktn
tneflidvdkgenycfsvqavipsrtvnrkstdspvec

SCOPe Domain Coordinates for d1wtgt2:

Click to download the PDB-style file with coordinates for d1wtgt2.
(The format of our PDB-style files is described here.)

Timeline for d1wtgt2: