Lineage for d1wtgt1 (1wtg T:6-108)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657284Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 657310Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)
  8. 657319Domain d1wtgt1: 1wtg T:6-108 [121266]
    Other proteins in same PDB: d1wtgh1, d1wtgl1, d1wtgl2, d1wtgl3
    automatically matched to d1a21a1
    complexed with 3bp, bgc, ca, fuc

Details for d1wtgt1

PDB Entry: 1wtg (more details), 2.2 Å

PDB Description: Human Factor Viia-Tissue Factor Complexed with ethylsulfonamide-D-biphenylalanine-Gln-p-aminobenzamidine
PDB Compounds: (T:) tissue factor

SCOP Domain Sequences for d1wtgt1:

Sequence, based on SEQRES records: (download)

>d1wtgt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

Sequence, based on observed residues (ATOM records): (download)

>d1wtgt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypeplyenspeftpyletnl

SCOP Domain Coordinates for d1wtgt1:

Click to download the PDB-style file with coordinates for d1wtgt1.
(The format of our PDB-style files is described here.)

Timeline for d1wtgt1: