SCOPe 2.08: Domain d1wtgt1: 1wtg T:6-108

Lineage for d1wtgt1 (1wtg T:6-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
   Uniprot P13726 33-242

8. Domain d1wtgt1: 1wtg T:6-108 [121266]
   Other proteins in same PDB: d1wtgh_, d1wtgl1, d1wtgl2, d1wtgl3
   automatically matched to d1a21a1
   complexed with 3bp, bgc, ca, fuc

Details for d1wtgt1

PDB Entry: 1wtg, 2.2 Å

PDB Description: human factor viia-tissue factor complexed with ethylsulfonamide-d- biphenylalanine-gln-p-aminobenzamidine

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1wtgt1:

Sequence, based on SEQRES records:

>d1wtgt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

Sequence, based on observed residues (ATOM records):

>d1wtgt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypeplyenspeftpyletnl

Timeline for d1wtgt1:

• d1wtgt1 first appeared in SCOP 1.73
  
• d1wtgt1 appears in SCOPe 2.07