Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Factor IX (IXa) [57198] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries) |
Domain d1wtgl1: 1wtg L:46-82 [121263] Other proteins in same PDB: d1wtgh_, d1wtgl3, d1wtgt1, d1wtgt2 automatically matched to d1pfxl1 complexed with 3bp, bgc, ca, fuc |
PDB Entry: 1wtg (more details), 2.2 Å
SCOPe Domain Sequences for d1wtgl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wtgl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} dgdqcasspcqnggsckdqlqsyicfclpafegrnce
Timeline for d1wtgl1: