Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein automated matches [190044] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187233] (110 PDB entries) |
Domain d1wtgh_: 1wtg H: [121262] Other proteins in same PDB: d1wtgl1, d1wtgl2, d1wtgl3, d1wtgt1, d1wtgt2 automated match to d1cvwh_ complexed with 3bp, bgc, ca, fuc |
PDB Entry: 1wtg (more details), 2.2 Å
SCOPe Domain Sequences for d1wtgh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wtgh_ b.47.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d1wtgh_: