Lineage for d1wtfd1 (1wtf D:1-81)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861004Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 861077Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
    contains only one 4Fe-4S cluster
  6. 861084Protein Ferredoxin [54882] (1 species)
  7. 861085Species Bacillus thermoproteolyticus [TaxId:1427] [54883] (3 PDB entries)
  8. 861091Domain d1wtfd1: 1wtf D:1-81 [121261]
    automatically matched to d1iqza_
    complexed with coa, f3s, so4

Details for d1wtfd1

PDB Entry: 1wtf (more details), 1.6 Å

PDB Description: Crystal structure of Bacillus thermoproteolyticus Ferredoxin Variants Containing Unexpected [3Fe-4S] Cluster that is linked to Coenzyme A at 1.6 A Resolution
PDB Compounds: (D:) ferredoxin

SCOP Domain Sequences for d1wtfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtfd1 d.58.1.4 (D:1-81) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]}
pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
cptdsikvadepfdgdpnkfe

SCOP Domain Coordinates for d1wtfd1:

Click to download the PDB-style file with coordinates for d1wtfd1.
(The format of our PDB-style files is described here.)

Timeline for d1wtfd1: