Lineage for d1wtfd_ (1wtf D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949195Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
    contains only one 4Fe-4S cluster
    automatically mapped to Pfam PF13459
    automatically mapped to Pfam PF13370
  6. 2949223Protein automated matches [190107] (2 species)
    not a true protein
  7. 2949224Species Bacillus thermoproteolyticus [TaxId:1427] [186831] (1 PDB entry)
  8. 2949228Domain d1wtfd_: 1wtf D: [121261]
    automated match to d1iqza_
    complexed with coa, f3s, so4

Details for d1wtfd_

PDB Entry: 1wtf (more details), 1.6 Å

PDB Description: Crystal structure of Bacillus thermoproteolyticus Ferredoxin Variants Containing Unexpected [3Fe-4S] Cluster that is linked to Coenzyme A at 1.6 A Resolution
PDB Compounds: (D:) ferredoxin

SCOPe Domain Sequences for d1wtfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtfd_ d.58.1.4 (D:) automated matches {Bacillus thermoproteolyticus [TaxId: 1427]}
pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
cptdsikvadepfdgdpnkfe

SCOPe Domain Coordinates for d1wtfd_:

Click to download the PDB-style file with coordinates for d1wtfd_.
(The format of our PDB-style files is described here.)

Timeline for d1wtfd_: