SCOPe 2.07: Domain d1wtfc_: 1wtf C:

Lineage for d1wtfc_ (1wtf C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
   contains only one 4Fe-4S cluster
   automatically mapped to Pfam PF13459
   automatically mapped to Pfam PF13370

6. Protein automated matches [190107] (2 species)
   not a true protein

7. Species Bacillus thermoproteolyticus [TaxId:1427] [186831] (1 PDB entry)

8. Domain d1wtfc_: 1wtf C: [121260]
   automated match to d1iqza_
   complexed with coa, f3s, so4

Details for d1wtfc_

PDB Entry: 1wtf, 1.6 Å

PDB Description: Crystal structure of Bacillus thermoproteolyticus Ferredoxin Variants Containing Unexpected [3Fe-4S] Cluster that is linked to Coenzyme A at 1.6 A Resolution

PDB Compounds: (C:) ferredoxin

SCOPe Domain Sequences for d1wtfc_:

Sequence; same for both SEQRES and ATOM records:

>d1wtfc_ d.58.1.4 (C:) automated matches {Bacillus thermoproteolyticus [TaxId: 1427]}
pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
cptdsikvadepfdgdpnkfe

Timeline for d1wtfc_:

• d1wtfc_ first appeared in SCOP 1.73, called d1wtfc1
  
• d1wtfc_ appears in SCOPe 2.06
  
• d1wtfc_ appears in the current release, SCOPe 2.08