SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1wtfa_ (1wtf A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172289Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2172388Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 protein domains)
    contains only one 4Fe-4S cluster
    automatically mapped to Pfam PF13459
    automatically mapped to Pfam PF13370
  6. 2172416Protein automated matches [190107] (2 species)
    not a true protein
  7. 2172417Species Bacillus thermoproteolyticus [TaxId:1427] [186831] (1 PDB entry)
  8. 2172418Domain d1wtfa_: 1wtf A: [121258]
    automated match to d1iqza_
    complexed with coa, f3s, so4

Details for d1wtfa_

PDB Entry: 1wtf (more details), 1.6 Å

PDB Description: Crystal structure of Bacillus thermoproteolyticus Ferredoxin Variants Containing Unexpected [3Fe-4S] Cluster that is linked to Coenzyme A at 1.6 A Resolution
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1wtfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtfa_ d.58.1.4 (A:) automated matches {Bacillus thermoproteolyticus [TaxId: 1427]}
pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
cptdsikvadepfdgdpnkfe

SCOPe Domain Coordinates for d1wtfa_:

Click to download the PDB-style file with coordinates for d1wtfa_.
(The format of our PDB-style files is described here.)

Timeline for d1wtfa_: