SCOPe 2.03: Domain d1wtba1: 1wtb A:183-257

Lineage for d1wtba1 (1wtb A:183-257)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Nuclear ribonucleoprotein D0 (AUF1) [75439] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75440] (3 PDB entries)

8. Domain d1wtba1: 1wtb A:183-257 [121256]
   automatically matched to d1iqta_
   protein/DNA complex; protein/RNA complex

Details for d1wtba1

PDB Entry: 1wtb

PDB Description: complex structure of the c-terminal rna-binding domain of hnrnp d (auf1) with telomere dna

PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein D0

SCOPe Domain Sequences for d1wtba1:

Sequence; same for both SEQRES and ATOM records:

>d1wtba1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}
kifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkimek
kyhnvglskceikva

Timeline for d1wtba1:

• d1wtba1 first appeared in SCOP 1.73
  
• d1wtba1 appears in SCOPe 2.02
  
• d1wtba1 is called d1wtba_ in SCOPe 2.04
  
• d1wtba1 appears in the current release, SCOPe 2.08, called d1wtba_