Lineage for d1wtba1 (1wtb A:183-257)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724438Protein Nuclear ribonucleoprotein D0 (AUF1) [75439] (1 species)
  7. 724439Species Human (Homo sapiens) [TaxId:9606] [75440] (3 PDB entries)
  8. 724442Domain d1wtba1: 1wtb A:183-257 [121256]
    automatically matched to d1iqta_

Details for d1wtba1

PDB Entry: 1wtb (more details)

PDB Description: complex structure of the c-terminal rna-binding domain of hnrnp d (auf1) with telomere dna
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein D0

SCOP Domain Sequences for d1wtba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtba1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}
kifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkimek
kyhnvglskceikva

SCOP Domain Coordinates for d1wtba1:

Click to download the PDB-style file with coordinates for d1wtba1.
(The format of our PDB-style files is described here.)

Timeline for d1wtba1: