Lineage for d1wtba_ (1wtb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952350Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)
  8. 2952432Domain d1wtba_: 1wtb A: [121256]
    automated match to d1x0fa1
    protein/DNA complex; protein/RNA complex

Details for d1wtba_

PDB Entry: 1wtb (more details)

PDB Description: complex structure of the c-terminal rna-binding domain of hnrnp d (auf1) with telomere dna
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein D0

SCOPe Domain Sequences for d1wtba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtba_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkkifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkim
ekkyhnvglskceikvams

SCOPe Domain Coordinates for d1wtba_:

Click to download the PDB-style file with coordinates for d1wtba_.
(The format of our PDB-style files is described here.)

Timeline for d1wtba_: