Lineage for d1wt9a1 (1wt9 A:1-129)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226321Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1226589Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1226602Species Hundred-pace snake (Deinagkistrodon acutus), different isoforms [TaxId:36307] [88865] (3 PDB entries)
  8. 1226603Domain d1wt9a1: 1wt9 A:1-129 [121254]
    Other proteins in same PDB: d1wt9b_
    complexed with ca

Details for d1wt9a1

PDB Entry: 1wt9 (more details), 2.01 Å

PDB Description: crystal structure of Aa-X-bp-I, a snake venom protein with the activity of binding to coagulation factor X from Agkistrodon acutus
PDB Compounds: (A:) agkisacutacin A chain

SCOPe Domain Sequences for d1wt9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wt9a1 d.169.1.1 (A:1-129) Snake coagglutinin alpha chain {Hundred-pace snake (Deinagkistrodon acutus), different isoforms [TaxId: 36307]}
dcssgwssyeghcykvfkqsktwtdaesfctkqvngghlvsiessgeadfvgqliaqkik
sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhietgfhkwenfyce
qqdpfvcea

SCOPe Domain Coordinates for d1wt9a1:

Click to download the PDB-style file with coordinates for d1wt9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wt9a1: