Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Snake coagglutinin alpha chain [88861] (10 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
Species Hundred-pace snake (Deinagkistrodon acutus), different isoforms [TaxId:36307] [88865] (3 PDB entries) |
Domain d1wt9a1: 1wt9 A:1-129 [121254] Other proteins in same PDB: d1wt9b_ complexed with ca |
PDB Entry: 1wt9 (more details), 2.01 Å
SCOPe Domain Sequences for d1wt9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wt9a1 d.169.1.1 (A:1-129) Snake coagglutinin alpha chain {Hundred-pace snake (Deinagkistrodon acutus), different isoforms [TaxId: 36307]} dcssgwssyeghcykvfkqsktwtdaesfctkqvngghlvsiessgeadfvgqliaqkik sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhietgfhkwenfyce qqdpfvcea
Timeline for d1wt9a1: