Class g: Small proteins [56992] (85 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) |
Family g.3.7.2: Short-chain scorpion toxins [57116] (34 proteins) |
Protein Bmkx [103546] (1 species) |
Species Chinese scorpion (Buthus martensi karsch) [TaxId:34649] [103547] (2 PDB entries) |
Domain d1wt8a1: 1wt8 A:1-31 [121253] automatically matched to d1rjia_ |
PDB Entry: 1wt8 (more details)
SCOP Domain Sequences for d1wt8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wt8a1 g.3.7.2 (A:1-31) Bmkx {Chinese scorpion (Buthus martensi karsch) [TaxId: 34649]} tpypvncktdrdcvmcglgisckngycqgct
Timeline for d1wt8a1: