Lineage for d1wt8a1 (1wt8 A:1-31)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747384Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 747457Family g.3.7.2: Short-chain scorpion toxins [57116] (34 proteins)
  6. 747473Protein Bmkx [103546] (1 species)
  7. 747474Species Chinese scorpion (Buthus martensi karsch) [TaxId:34649] [103547] (2 PDB entries)
  8. 747476Domain d1wt8a1: 1wt8 A:1-31 [121253]
    automatically matched to d1rjia_

Details for d1wt8a1

PDB Entry: 1wt8 (more details)

PDB Description: solution structure of bmp08 from the venom of scorpion buthus martensii karsch, 20 structures
PDB Compounds: (A:) Neurotoxin BmK X

SCOP Domain Sequences for d1wt8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wt8a1 g.3.7.2 (A:1-31) Bmkx {Chinese scorpion (Buthus martensi karsch) [TaxId: 34649]}
tpypvncktdrdcvmcglgisckngycqgct

SCOP Domain Coordinates for d1wt8a1:

Click to download the PDB-style file with coordinates for d1wt8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wt8a1: