Lineage for d1wsud2 (1wsu D:575-634)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635621Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (1 protein)
  6. 635622Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
    duplication: tandem repeat of four "winged helix" domains
  7. 635623Species Moorella thermoacetica [TaxId:1525] [74685] (3 PDB entries)
  8. 635641Domain d1wsud2: 1wsu D:575-634 [121252]
    automatically matched to d1lvaa4

Details for d1wsud2

PDB Entry: 1wsu (more details), 2.3 Å

PDB Description: C-terminal domain of elongation factor selB complexed with SECIS RNA
PDB Compounds: (D:) Selenocysteine-specific elongation factor

SCOP Domain Sequences for d1wsud2:

Sequence, based on SEQRES records: (download)

>d1wsud2 a.4.5.35 (D:575-634) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
qalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvvgn

Sequence, based on observed residues (ATOM records): (download)

>d1wsud2 a.4.5.35 (D:575-634) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
qalgeareviknlagpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvvgn

SCOP Domain Coordinates for d1wsud2:

Click to download the PDB-style file with coordinates for d1wsud2.
(The format of our PDB-style files is described here.)

Timeline for d1wsud2: