Lineage for d1wsua1 (1wsu A:512-574)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762639Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (1 protein)
  6. 762640Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
    duplication: tandem repeat of four "winged helix" domains
  7. 762641Species Moorella thermoacetica [TaxId:1525] [74685] (5 PDB entries)
  8. 762654Domain d1wsua1: 1wsu A:512-574 [121245]
    automatically matched to d1lvaa3

Details for d1wsua1

PDB Entry: 1wsu (more details), 2.3 Å

PDB Description: C-terminal domain of elongation factor selB complexed with SECIS RNA
PDB Compounds: (A:) Selenocysteine-specific elongation factor

SCOP Domain Sequences for d1wsua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wsua1 a.4.5.35 (A:512-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
setqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindefy
whr

SCOP Domain Coordinates for d1wsua1:

Click to download the PDB-style file with coordinates for d1wsua1.
(The format of our PDB-style files is described here.)

Timeline for d1wsua1: